Structure of PDB 2hdc Chain A

Receptor sequence

>2hdcA (length=97) Species: 10116 (Rattus norvegicus) [Search protein sequence]

VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSI
RHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKR

3D structure

PDB

2hdc Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.

Chain

Resolution

N/A

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	P5 S7 Y8 I9 P45 N49 S50 H53 R66 E67 P68 R95 R98	P4 S6 Y7 I8 P44 N48 S49 H52 R65 E66 P67 R94 R97
BS02	dna	A	L26 R52 H53 K63 I64 P65 R66 N70 G72 K73 N75 W77 R95 K97 R98	L25 R51 H52 K62 I63 P64 R65 N69 G71 K72 N74 W76 R94 K96 R97

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677	DNA binding
GO:0003690	double-stranded DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding
GO:1990837	sequence-specific double-stranded DNA binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0001701	in utero embryonic development
GO:0001829	trophectodermal cell differentiation
GO:0001892	embryonic placenta development
GO:0006355	regulation of DNA-templated transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:1990830	cellular response to leukemia inhibitory factor

	Cellular Component
GO:0000785	chromatin
GO:0005634	nucleus

External links

PDB	RCSB:2hdc, PDBe:2hdc, PDBj:2hdc
PDBsum	2hdc
PubMed	10369754
UniProt	Q63245\|FOXD3_RAT Forkhead box protein D3 (Fragment) (Gene Name=Foxd3)