Structure of PDB 2hba Chain A

Receptor sequence

>2hbaA (length=52) Species: 1422 (Geobacillus stearothermophilus)

MKVIFLKDVKGMGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQ
KQ

3D structure

• PDB: 2hba Energetically significant networks of coupled interactions within an unfolded protein.
• Chain: A
• Resolution: 1.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	M1 D23	M1 D23

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:2hba, PDBe:2hba, PDBj:2hba
• PDBsum: 2hba
• PubMed: 25099351
• UniProt: P02417|RL9_GEOSE Large ribosomal subunit protein bL9 (Gene Name=rplI)