Structure of PDB 2hax Chain A

Receptor sequence
>2haxA (length=66) Species: 1394 ([Bacillus] caldolyticus) [Search protein sequence]
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFE
IVQGNRGPQAANVVKL
3D structure
PDB2hax Common mode of DNA binding to cold shock domains. Crystal structure of hexathymidine bound to the domain-swapped form of a major cold shock protein from Bacillus caldolyticus.
ChainA
Resolution1.29 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A W8 N10 N11 E12 K13 G14 Y15 F17 D25 F27 H29 F30 W8 N10 N11 E12 K13 G14 Y15 F17 D25 F27 H29 F30
BS02 dna A F38 K39 R56 P58 Q59 F38 K39 R56 P58 Q59
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2hax, PDBe:2hax, PDBj:2hax
PDBsum2hax
PubMed17266726
UniProtP41016|CSPB_BACCL Cold shock protein CspB (Gene Name=cspB)

[Back to BioLiP]