Structure of PDB 2hah Chain A

Receptor sequence

>2hahA (length=112) Species: 11674 (Feline immunodeficiency virus (isolate Petaluma))

GTTTTLEKRPEILIFVNGYPIKFLLDTGADITVLNRRDFQVKNSIENGRQ
MIGGIGGFIRGTNYINVHLEIRDENYKTQCIFGNVCVLEDNSTPVNILGR
DNMIKFNIRLVM

3D structure

• PDB: 2hah Crystal structure of an FIV/HIV chimeric protease complexed with the broad-based inhibitor, TL-3.
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D30 T31 G32
• Catalytic site (residue number reindexed from 1): D26 T27 G28
• Enzyme Commision number: 3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	3TL	A	G32 A33 D34 Q54 I56 G57 G58 I59	G28 A29 D30 Q50 I52 G53 G54 I55	MOAD: Ki=10nM PDBbind-CN: -logKd/Ki=8.00,Ki=10nM

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:2hah, PDBe:2hah, PDBj:2hah
• PDBsum: 2hah
• PubMed: 17212810
• UniProt: Q66972