Structure of PDB 2h9d Chain A |
>2h9dA (length=84) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
MKTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFERVAAMLPE RARWAEENGLDAPFVEGLFAQIIHWYIAEQIKYW |
|
PDB | 2h9d Two Crystal Structures of the Isochorismate Pyruvate Lyase from Pseudomonas aeruginosa. |
Chain | A |
Resolution | 1.95 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PYR |
A |
R31 M57 |
R31 M47 |
|
|
|
|