Structure of PDB 2h5i Chain A |
>2h5iA (length=146) Species: 9606 (Homo sapiens) [Search protein sequence] |
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETF RNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIF GTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET |
|
PDB | 2h5i Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition |
Chain | A |
Resolution | 1.69 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
R64 C163 |
R36 C135 |
|
|
|
|