Structure of PDB 2h28 Chain A |
>2h28A (length=109) Species: 562 (Escherichia coli) [Search protein sequence] |
DRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQA FPLLMKQLELMLTSGELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVY PTPEMKNLE |
|
PDB | 2h28 Crystal Structures of Phd-Doc, HigA, and YeeU Establish Multiple Evolutionary Links between Microbial Growth-Regulating Toxin-Antitoxin Systems. |
Chain | A |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
H88 D102 T103 |
H73 D87 T88 |
|
|
|
|