Structure of PDB 2h1k Chain A

Receptor sequence
>2h1kA (length=58) Species: 10036 (Mesocricetus auratus) [Search protein sequence]
RTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNR
RMKWKKEE
3D structure
PDB2h1k Structural basis for induced fit mechanisms in DNA recognition by the pdx1 homeodomain
ChainA
Resolution2.42 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R5 Y25 R31 K46 Q50 R53 M54 K57 R3 Y23 R29 K44 Q48 R51 M52 K55 PDBbind-CN: Kd=1.2nM
BS02 dna A R3 R5 T6 Y8 I47 N51 K55 R1 R3 T4 Y6 I45 N49 K53 PDBbind-CN: Kd=1.2nM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2h1k, PDBe:2h1k, PDBj:2h1k
PDBsum2h1k
PubMed17315980
UniProtP70118|PDX1_MESAU Pancreas/duodenum homeobox protein 1 (Gene Name=PDX1)

[Back to BioLiP]