Structure of PDB 2h1c Chain A

Receptor sequence
>2h1cA (length=139) Species: 485 (Neisseria gonorrhoeae) [Search protein sequence]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALL
LNGKKKNVLHERLEQSILPLFAGRILPFDEPVAAIYAQIRSYAKTHGKEI
AAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHL
3D structure
PDB2h1c Structure of FitAB from Neisseria gonorrhoeae bound to DNA reveals a tetramer of toxin-antitoxin heterodimers containing pin domains and ribbon-helix-helix motifs.
ChainA
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A S10 P12 L13 R14 P15 L25 D26 G46 K55 R62 I67 L70 S10 P12 L13 R14 P15 L25 D26 G46 K55 R62 I67 L70
BS02 MG A L3 L4 L35 S36 T39 L3 L4 L35 S36 T39
BS03 MG A S36 L76 P77 F78 T110 S36 L76 P77 F78 T110
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0004518 nuclease activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0044001 migration in host

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2h1c, PDBe:2h1c, PDBj:2h1c
PDBsum2h1c
PubMed16982615
UniProtQ5F882|FITB_NEIG1 Toxin FitB (Gene Name=fitB)

[Back to BioLiP]