Structure of PDB 2h0k Chain A

Receptor sequence

>2h0kA (length=318) Species: 10116 (Rattus norvegicus) [Search protein sequence]

ALRGTVTDFSGFDGEADAEVLEKAMEGLGTDEDSILNLLTARSNAQRQQI
AEEFETLFGRDLVNDMKSELTGKFEKLIVALMKPSRLYDAYELKHALKGA
GTDEKVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQRML
VVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEEFITILGTRSV
SHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVKSIRSIPAYLAE
TLYYAMKGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIKGD
TSGDYKKALLLLSGGEDD

3D structure

PDB

2h0k Annexin-A5 assembled into two-dimensional arrays promotes cell membrane repair.

Chain

Resolution

2.76 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	M26 G28 G30 E70	M25 G27 G29 E69
BS02	CA	A	K68 L71 E76	K67 L70 E75
BS03	CA	A	T31 E33	T30 E32
BS04	CA	A	L98 G100 A101 D142	L97 G99 A100 D141
BS05	CA	A	T187 E226	T186 E225
BS06	CA	A	T103 E105	T102 E104
BS07	CA	A	T187 E189	T186 E188
BS08	CA	A	M257 G259 G261 D301	M256 G258 G260 D300
BS09	CA	A	D224 T227 E232	D223 T226 E231
BS10	CA	A	G181 K184 G186 E226	G180 K183 G185 E225
BS11	CA	A	E93 H265	E92 H264

Gene Ontology

	Molecular Function
GO:0001786	phosphatidylserine binding
GO:0005388	P-type calcium transporter activity
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005543	phospholipid binding
GO:0005544	calcium-dependent phospholipid binding
GO:0017046	peptide hormone binding
GO:0030971	receptor tyrosine kinase binding
GO:0042802	identical protein binding

	Biological Process
GO:0007596	blood coagulation
GO:0030195	negative regulation of blood coagulation
GO:0043065	positive regulation of apoptotic process
GO:0050819	negative regulation of coagulation
GO:0051592	response to calcium ion
GO:0070588	calcium ion transmembrane transport
GO:0071284	cellular response to lead ion
GO:0097066	response to thyroid hormone
GO:0097211	cellular response to gonadotropin-releasing hormone
GO:1901317	regulation of flagellated sperm motility
GO:1902721	negative regulation of prolactin secretion

	Cellular Component
GO:0005615	extracellular space
GO:0005737	cytoplasm
GO:0008021	synaptic vesicle
GO:0009897	external side of plasma membrane
GO:0012506	vesicle membrane
GO:0014704	intercalated disc
GO:0030018	Z disc
GO:0030425	dendrite
GO:0030672	synaptic vesicle membrane
GO:0042383	sarcolemma
GO:0042995	cell projection
GO:0043025	neuronal cell body
GO:0043204	perikaryon
GO:0043679	axon terminus
GO:0072563	endothelial microparticle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2h0k, PDBe:2h0k, PDBj:2h0k
PDBsum	2h0k
PubMed	21468022
UniProt	P14668\|ANXA5_RAT Annexin A5 (Gene Name=Anxa5)

[Back to BioLiP]