Structure of PDB 2gud Chain A

Receptor sequence
>2gudA (length=121) Species: 35158 (Griffithsia) [Search protein sequence]
SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIIDGVHHGGSGGNLSPTF
TFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKV
IQINGSAGDYLDSLDIYYEQY
3D structure
PDB2gud Domain-swapped structure of the potent antiviral protein griffithsin and its mode of carbohydrate binding.
ChainA
Resolution0.94 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MAN A G108 D109 Y110 D112 G108 D109 Y110 D112
BS02 BMA A G108 D109 Y110 D112 G108 D109 Y110 D112
BS03 MAN A G26 S27 Y28 D30 G44 G26 S27 Y28 D30 G44
BS04 MAN A G66 D67 Y68 D70 G89 G90 G66 D67 Y68 D70 G89 G90
BS05 BMA A G66 D67 Y68 D70 G89 G90 G66 D67 Y68 D70 G89 G90
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005536 D-glucose binding
GO:0005537 D-mannose binding
GO:0030246 carbohydrate binding
GO:0042802 identical protein binding
GO:0046871 N-acetylgalactosamine binding
Biological Process
GO:0008150 biological_process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2gud, PDBe:2gud, PDBj:2gud
PDBsum2gud
PubMed16843894
UniProtP84801|GRFIN_GRISQ Griffithsin

[Back to BioLiP]