Structure of PDB 2gnk Chain A

Receptor sequence
>2gnkA (length=95) Species: 562 (Escherichia coli) [Search protein sequence]
MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGFLPKVKIDVAIAD
DQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL
3D structure
PDB2gnk GlnK, a PII-homologue: structure reveals ATP binding site and indicates how the T-loops may be involved in molecular recognition.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP A I7 G35 G37 K58 G87 G89 K90 I7 G35 G37 K41 G70 G72 K73
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0030234 enzyme regulator activity
GO:0042802 identical protein binding
Biological Process
GO:0006808 regulation of nitrogen utilization
GO:0045848 positive regulation of nitrogen utilization
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2gnk, PDBe:2gnk, PDBj:2gnk
PDBsum2gnk
PubMed9733647
UniProtP0AC55|GLNK_ECOLI Nitrogen regulatory protein GlnK (Gene Name=glnK)

[Back to BioLiP]