Structure of PDB 2gig Chain A

Receptor sequence

>2gigA (length=249) Species: 727 (Haemophilus influenzae)

SFIKPIYQDINSILIGQKVKRPHAAGEPFEKLVYKFLKENLSDLTFKQYE
YLNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEK
QNDTADILLVKDQFYELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDN
KEFDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQI
QFHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYI

3D structure

• PDB: 2gig Alteration of Sequence Specificity of the Type II Restriction Endonuclease HincII through an Indirect Readout Mechanism.
• Chain: A
• Resolution: 1.83 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	H31 G92 K93 K108 Q109 F138 Y199 N201 A203 A204 R241 K248	H23 G84 K85 K100 Q101 F130 Y191 N193 A195 A196 R233 K240	PDBbind-CN: Kd=1.03nM
BS02	dna	A	Q109 N110 D111 D114 D127 K129 T130 R131 S136 A137 F138 A139 P140 N141 S144 K147 A205 M206 Q207	Q101 N102 D103 D106 D119 K121 T122 R123 S128 A129 F130 A131 P132 N133 S136 K139 A197 M198 Q199	PDBbind-CN: Kd=1.03nM

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:2gig, PDBe:2gig, PDBj:2gig
• PDBsum: 2gig
• PubMed: 16675462
• UniProt: P17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)