Structure of PDB 2gco Chain A

Receptor sequence
>2gcoA (length=188) Species: 9606 (Homo sapiens) [Search protein sequence]
HHHSSGLVPAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY
IADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSL
ENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSE
EGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQ
3D structure
PDB2gco X-ray Crystal Structures Reveal Two Activated States for RhoC.
ChainA
Resolution1.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A T19 T37 T27 T45
BS02 GNP A A15 G17 K18 T19 C20 G62 K118 D120 L121 S160 A161 K162 A23 G25 K26 T27 C28 G70 K126 D128 L129 S168 A169 K170
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019901 protein kinase binding
Biological Process
GO:0000281 mitotic cytokinesis
GO:0007015 actin filament organization
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0030335 positive regulation of cell migration
GO:0031334 positive regulation of protein-containing complex assembly
GO:0032956 regulation of actin cytoskeleton organization
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0043297 apical junction assembly
GO:0044319 wound healing, spreading of cells
GO:0051496 positive regulation of stress fiber assembly
GO:0060193 positive regulation of lipase activity
GO:1902766 skeletal muscle satellite cell migration
Cellular Component
GO:0005634 nucleus
GO:0005789 endoplasmic reticulum membrane
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0032154 cleavage furrow
GO:0032420 stereocilium
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2gco, PDBe:2gco, PDBj:2gco
PDBsum2gco
PubMed17497936
UniProtP08134|RHOC_HUMAN Rho-related GTP-binding protein RhoC (Gene Name=RHOC)

[Back to BioLiP]