Structure of PDB 2g1u Chain A

Receptor sequence
>2g1uA (length=137) Species: 2336 (Thermotoga maritima) [Search protein sequence]
KQKSKYIVIFGCGRLGSLIANLASSSGHSVVVVDKNEYAFHRLNSEFSGF
TVVGDAAEFETLKECGMEKADMVFAFTNDDSTNFFISMNARYMFNVENVI
ARVYDPEKIKIFEENGIKTICPAVLMIEKVKEFIIGS
3D structure
PDB2g1u Crystal structure of (tm1088a) from THERMOTOGA MARITIMA at 1.50 A resolution
ChainA
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AMP A G16 R17 D37 K38 D58 A59 T80 N81 G13 R14 D34 K35 D55 A56 T77 N78
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 30 09:34:40 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '2g1u', asym_id = 'A', title = 'Crystal structure of (tm1088a) from THERMOTOGA MARITIMA at 1.50 A resolution'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='2g1u', asym_id='A', title='Crystal structure of (tm1088a) from THERMOTOGA MARITIMA at 1.50 A resolution')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0005886,0006813,0015079', uniprot = '', pdbid = '2g1u', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005886,0006813,0015079', uniprot='', pdbid='2g1u', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>