Structure of PDB 2g0y Chain A |
>2g0yA (length=133) Species: 43989 (Crocosphaera subtropica ATCC 51142) [Search protein sequence] |
SASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALI GADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFS LAVLDVYEVDKLCDRADGVNPKTGVSTRESLRC |
|
PDB | 2g0y Characterization of two potentially universal turn motifs that shape the repeated five-residues fold - Crystal structure of a lumenal pentapeptide repeat protein from Cyanothece 51142 |
Chain | A |
Resolution | 2.3 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
T132 |
Catalytic site (residue number reindexed from 1) |
T127 |
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
D36 G56 |
D31 G51 |
|
|
|
|