Structure of PDB 2fzw Chain A

Receptor sequence
>2fzwA (length=373) Species: 9606 (Homo sapiens) [Search protein sequence]
ANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYT
LSGADPEGCFPVILGHLGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECK
FCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTV
VADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLG
GVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQ
EVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEI
ATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLS
FDEINKAFELMHSGKSIRTVVKI
3D structure
PDB2fzw Structure-function relationships in human glutathione-dependent formaldehyde dehydrogenase. Role of Glu-67 and Arg-368 in the catalytic mechanism.
ChainA
Resolution1.84 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C44 H45 T46 Y49 H66 L67 C96 C99 C102 C110 R114 C173 T177 R368
Catalytic site (residue number reindexed from 1) C44 H45 T46 Y49 H66 L67 C96 C99 C102 C110 R114 C173 T177 R368
Enzyme Commision number 1.1.1.-
1.1.1.1: alcohol dehydrogenase.
1.1.1.284: S-(hydroxymethyl)glutathione dehydrogenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C96 C99 C102 C110 C96 C99 C102 C110
BS02 ZN A C44 H66 C173 C44 H66 C173
BS03 PO4 A K83 K158 K83 K158
BS04 NAD A C173 T177 G200 V202 D222 I223 C267 I268 V291 G292 V293 R368 C173 T177 G200 V202 D222 I223 C267 I268 V291 G292 V293 R368 MOAD: Kd=0.076uM
Gene Ontology
Molecular Function
GO:0004022 alcohol dehydrogenase (NAD+) activity
GO:0005504 fatty acid binding
GO:0008270 zinc ion binding
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0018467 formaldehyde dehydrogenase (NAD+) activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0051903 S-(hydroxymethyl)glutathione dehydrogenase [NAD(P)+] activity
GO:0080007 S-nitrosoglutathione reductase (NADH) activity
GO:0106321 S-(hydroxymethyl)glutathione dehydrogenase (NADP+) activity
GO:0106322 S-(hydroxymethyl)glutathione dehydrogenase (NAD+) activity
Biological Process
GO:0001523 retinoid metabolic process
GO:0003016 respiratory system process
GO:0006629 lipid metabolic process
GO:0010430 fatty acid omega-oxidation
GO:0032496 response to lipopolysaccharide
GO:0044281 small molecule metabolic process
GO:0045777 positive regulation of blood pressure
GO:0046294 formaldehyde catabolic process
GO:0051409 response to nitrosative stress
GO:0051775 response to redox state
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2fzw, PDBe:2fzw, PDBj:2fzw
PDBsum2fzw
PubMed16605250
UniProtP11766|ADHX_HUMAN Alcohol dehydrogenase class-3 (Gene Name=ADH5)

[Back to BioLiP]