Structure of PDB 2fzs Chain A

Receptor sequence
>2fzsA (length=186) Species: 562 (Escherichia coli) [Search protein sequence]
LVPMVIERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEK
DIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAGA
KGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHT
GQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN
3D structure
PDB2fzs Crystal structure at 1.9A of E. coli ClpP with a peptide covalently bound at the active site.
ChainA
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G68 S97 M98 H122 D171
Catalytic site (residue number reindexed from 1) G61 S90 M91 H115 D164
Enzyme Commision number 3.4.21.92: endopeptidase Clp.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CMQ A G67 G68 V69 I70 S97 M98 H122 P124 L125 I142 M149 G60 G61 V62 I63 S90 M91 H115 P117 L118 I135 M142
Gene Ontology
Molecular Function
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0008236 serine-type peptidase activity
GO:0042802 identical protein binding
GO:0051117 ATPase binding
Biological Process
GO:0006508 proteolysis
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
GO:0009266 response to temperature stimulus
GO:0009314 response to radiation
GO:0009408 response to heat
GO:0010498 proteasomal protein catabolic process
GO:0043068 positive regulation of programmed cell death
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009368 endopeptidase Clp complex
GO:0009376 HslUV protease complex
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2fzs, PDBe:2fzs, PDBj:2fzs
PDBsum2fzs
PubMed16682229
UniProtP0A6G7|CLPP_ECOLI ATP-dependent Clp protease proteolytic subunit (Gene Name=clpP)

[Back to BioLiP]