Structure of PDB 2fzi Chain A

Receptor sequence
>2fziA (length=206) Species: 4754 (Pneumocystis carinii) [Search protein sequence]
MNQQKSLTLIVALTTSYGIGRSNSLPWKLKKEISYFKRVTSFVPTFDSFE
SMNVVLMGRKTWESIPLQFRPLKGRINVVITRNESLDLGNGIHSAKSLDH
ALELLYRTYGSESSVQINRIFVIGGAQLYKAAMDHPKLDRIMATIIYKDI
HCDVFFPLKFRDKEWSSVWKKEKHSDLESWVGTKVPHGKINEDGFDYEFE
MWTRDL
3D structure
PDB2fzi New insights into DHFR interactions: analysis of Pneumocystis carinii and mouse DHFR complexes with NADPH and two highly potent 5-(omega-carboxy(alkyloxy) trimethoprim derivatives reveals conformational correlations with activity and novel parallel ring stacking interactions.
ChainA
Resolution1.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) L25 E32
Catalytic site (residue number reindexed from 1) L25 E32
Enzyme Commision number 1.5.1.3: dihydrofolate reductase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 NDP A V11 A12 I19 G20 S24 L25 G58 R59 K60 T61 I80 T81 R82 K96 I123 G125 A126 Q127 L128 V154 V11 A12 I19 G20 S24 L25 G58 R59 K60 T61 I80 T81 R82 K96 I123 G125 A126 Q127 L128 V154
BS02 DH3 A I10 V11 A12 L25 E32 I33 F36 K37 S64 F69 R75 I123 I10 V11 A12 L25 E32 I33 F36 K37 S64 F69 R75 I123 MOAD: ic50=1nM
BindingDB: IC50=1nM
Gene Ontology
Molecular Function
GO:0004146 dihydrofolate reductase activity
GO:0016491 oxidoreductase activity
GO:0050661 NADP binding
Biological Process
GO:0006730 one-carbon metabolic process
GO:0046452 dihydrofolate metabolic process
GO:0046654 tetrahydrofolate biosynthetic process
GO:0046655 folic acid metabolic process
Cellular Component
GO:0005739 mitochondrion

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2fzi, PDBe:2fzi, PDBj:2fzi
PDBsum2fzi
PubMed17019704
UniProtP16184|DYR_PNECA Dihydrofolate reductase

[Back to BioLiP]