Structure of PDB 2fz6 Chain A |
>2fz6A (length=72) Species: 51453 (Trichoderma reesei) [Search protein sequence] |
NGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKT GAQPLCCVAPVAGQALLCQTAV |
|
PDB | 2fz6 Two crystal structures of Trichoderma reesei hydrophobin HFBI--The structure of a protein amphiphile with and without detergent interaction. |
Chain | A |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D40 D43 |
D39 D42 |
|
|
|
|