Structure of PDB 2fxu Chain A

Receptor sequence
>2fxuA (length=361) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
ETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVDSYVGDEAQS
KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPL
NPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVT
HNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVR
DIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPET
LFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIA
DRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQ
EYDEAGPSIVH
3D structure
PDB2fxu Structure of bistramide a-actin complex at a 1.35 A resolution
ChainA
Resolution1.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A Q263 S265 Q253 S255
BS02 CA A D286 D288 D276 D278
BS03 ATP A G13 S14 G15 K18 G156 D157 G158 V159 G182 K213 E214 G302 M305 Y306 G10 S11 G12 K15 G146 D147 G148 V149 G172 K203 E204 G292 M295 Y296
BS04 BID A Y133 A135 I136 Y143 Y169 A170 P172 T351 F352 M355 Y123 A125 I126 Y133 Y159 A160 P162 T341 F342 M345 MOAD: Kd=7nM
PDBbind-CN: -logKd/Ki=8.15,Kd=7nM
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003785 actin monomer binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005523 tropomyosin binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0019904 protein domain specific binding
GO:0031013 troponin I binding
GO:0031432 titin binding
GO:0032036 myosin heavy chain binding
GO:0042802 identical protein binding
GO:0048306 calcium-dependent protein binding
GO:0140660 cytoskeletal motor activator activity
Biological Process
GO:0010628 positive regulation of gene expression
GO:0030041 actin filament polymerization
GO:0030240 skeletal muscle thin filament assembly
GO:0048741 skeletal muscle fiber development
GO:0051017 actin filament bundle assembly
GO:0090131 mesenchyme migration
Cellular Component
GO:0001725 stress fiber
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005865 striated muscle thin filament
GO:0005884 actin filament
GO:0030027 lamellipodium
GO:0030175 filopodium
GO:0031941 filamentous actin
GO:0032432 actin filament bundle
GO:0044297 cell body
GO:0098723 skeletal muscle myofibril

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2fxu, PDBe:2fxu, PDBj:2fxu
PDBsum2fxu
PubMed16551075
UniProtP68135|ACTS_RABIT Actin, alpha skeletal muscle (Gene Name=ACTA1)

[Back to BioLiP]