Structure of PDB 2fxi Chain A

Receptor sequence
>2fxiA (length=131) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MDKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIE
AMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEH
WGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
3D structure
PDB2fxi Interplay Between Ion Binding and Catalysis in the Thioredoxin-coupled Arsenate Reductase Family.
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) S10 T11 G12 N13 S14 A15 R16 S17 S36 T63 D65 C82 C89 D105
Catalytic site (residue number reindexed from 1) S10 T11 G12 N13 S14 A15 R16 S17 S36 T63 D65 C82 C89 D105
Enzyme Commision number 1.20.4.4: arsenate reductase (thioredoxin).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 K A N13 Q18 E21 S36 T63 S64 D65 N13 Q18 E21 S36 T63 S64 D65
Gene Ontology
Molecular Function
GO:0004725 protein tyrosine phosphatase activity
GO:0016491 oxidoreductase activity
GO:0030612 arsenate reductase (thioredoxin) activity
GO:0046872 metal ion binding
Biological Process
GO:0046685 response to arsenic-containing substance
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2fxi, PDBe:2fxi, PDBj:2fxi
PDBsum2fxi
PubMed16797027
UniProtP0A006|ARSC_STAAU Arsenate reductase (Gene Name=arsC)

[Back to BioLiP]