Structure of PDB 2fxd Chain A |
>2fxdA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPIVTVKIGGQLKEALLDTGADDTVIEEMNLPGKWKPKIIGGI GGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPFNVIGRNLMTQIGATLNF |
|
PDB | 2fxd X-ray crystal structures of human immunodeficiency virus type 1 protease mutants complexed with atazanavir. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
3.1.26.13: retroviral ribonuclease H. |
|
|
|
|