Structure of PDB 2fr5 Chain A

Receptor sequence

>2fr5A (length=136) Species: 10090 (Mus musculus)

EPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACY
PLGVCAERTAIQKAISEGYKDFRAIAISSDLQEEFISPCGACRQVMREFG
TDWAVYMTKPDGTFVVRTVQELLPASFGPEDLQKIQ

3D structure

• PDB: 2fr5 The 1.48 A Resolution Crystal Structure of the Homotetrameric Cytidine Deaminase from Mouse
• Chain: A
• Resolution: 1.48 Å

Enzymatic activity

• Enzyme Commision number: 3.5.4.5: cytidine deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C65 C99 C102	C55 C89 C92
BS02	TYU	A	F36 V38 N54 E56 C65 E67 C99	F26 V28 N44 E46 C55 E57 C89
BS03	TYU	A	A58 C59 Y60 P61	A48 C49 Y50 P51

Gene Ontology

Molecular Function

• GO:0001882 nucleoside binding
• GO:0003824 catalytic activity
• GO:0004126 cytidine deaminase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0019239 deaminase activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006248 CMP catabolic process
• GO:0006249 dCMP catabolic process
• GO:0009972 cytidine deamination
• GO:0030308 negative regulation of cell growth
• GO:0044206 UMP salvage
• GO:0045980 negative regulation of nucleotide metabolic process
• GO:0046898 response to cycloheximide
• GO:0055086 nucleobase-containing small molecule metabolic process
• GO:0071217 cellular response to external biotic stimulus
• GO:0072527 pyrimidine-containing compound metabolic process
• GO:1901135 carbohydrate derivative metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:2fr5, PDBe:2fr5, PDBj:2fr5
• PDBsum: 2fr5
• PubMed: 16784234
• UniProt: P56389|CDD_MOUSE Cytidine deaminase (Gene Name=Cda)