Structure of PDB 2fot Chain A

Receptor sequence

>2fotA (length=134) Species: 9913 (Bos taurus)

EEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV
DADGNGTIDFPEFLTMMASEEEIREAFRVFDKDGNGYISAAELRHVMTNL
GEKTDEEVDEMIREADIDGDGQVNYEEFVQMMTA

3D structure

• PDB: 2fot Structure of the calmodulin alphaII-spectrin complex provides insight into the regulation of cell plasticity.
• Chain: A
• Resolution: 2.45 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): V35
• Catalytic site (residue number reindexed from 1): V30

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	E14 L18 F19 L32 M36 M51 E54 F68 M71 E84 M109 M124 A128 M144 M145 A147	E9 L13 F14 L27 M31 M46 E49 F63 M66 E72 M97 M111 A115 M131 M132 A134
BS02	CA	A	D20 D22 D24 T26 E31	D15 D17 D19 T21 E26
BS03	CA	A	D56 D58 N60 T62 E67	D51 D53 N55 T57 E62
BS04	CA	A	D93 D95 N97 Y99 E104	D81 D83 N85 Y87 E92
BS05	CA	A	D129 D131 D133 Q135 E140	D116 D118 D120 Q122 E127

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0019904 protein domain specific binding
• GO:0046872 metal ion binding

Biological Process

• GO:0010880 regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
• GO:0060315 negative regulation of ryanodine-sensitive calcium-release channel activity
• GO:0060316 positive regulation of ryanodine-sensitive calcium-release channel activity

Cellular Component

• GO:0000922 spindle pole
• GO:0005737 cytoplasm
• GO:0005819 spindle
• GO:0005829 cytosol
• GO:0005856 cytoskeleton
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:2fot, PDBe:2fot, PDBj:2fot
• PDBsum: 2fot
• PubMed: 16945920
• UniProt: P62157|CALM_BOVIN Calmodulin (Gene Name=CALM)