Structure of PDB 2fmk Chain A

Receptor sequence
>2fmkA (length=128) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence]
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGF
GFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQA
GASGYVVKPFTAATLEEKLNKIFEKLGM
3D structure
PDB2fmk Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation
ChainA
Resolution1.999 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A A90 K92 I95 A99 A103 Y106 V107 V108 K119 K122 A89 K91 I94 A98 A102 Y105 V106 V107 K118 K121
BS02 MG A D13 D57 N59 D12 D56 N58
BS03 BEF A D57 W58 N59 T87 A88 K109 D56 W57 N58 T86 A87 K108
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006935 chemotaxis
GO:0097588 archaeal or bacterial-type flagellum-dependent cell motility
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2fmk, PDBe:2fmk, PDBj:2fmk
PDBsum2fmk
PubMed16674976
UniProtP0A2D5|CHEY_SALTY Chemotaxis protein CheY (Gene Name=cheY)

[Back to BioLiP]