Structure of PDB 2fll Chain A

Receptor sequence

>2fllA (length=373) Species: 9606 (Homo sapiens)

ASSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQKYLVVTCNYEARKLG
VKKLMNVRDAKEKCPQLVLVNGEDLTRYREMSYKVTELLEEFSPVVERLG
FDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLDVLHIRLL
VGSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPE
SCQHLIHSLNHIKEIPGIGYKTAKCLEALGINSVRDLQTFSPKILEKELG
ISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSFKKCSSEVEAKNKIEEL
LASLLNRVCQDGRKPHTVRLIIRRYSSEKHYGRESRQCPIPSHVIQVMTP
MVDILMKLFRNMTLLSVCFCNLK

3D structure

• PDB: 2fll An incoming nucleotide imposes an anti to syn conformational change on the templating purine in the human DNA polymerase-iota active site.
• Chain: A
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	E127 K207 I242 G243 K245 T246 E358 S359	E103 K183 I218 G219 K221 T222 E334 S335
BS02	dna	A	Q59 K60 E97 L99 Q300 S301 S303 E304 E305 S307 K309 R347	Q35 K36 E73 L75 Q276 S277 S279 E280 E281 S283 K285 R323
BS03	MG	A	D34 L35 D126	D10 L11 D102
BS04	MG	A	D34 E127	D10 E103
BS05	TTP	A	L35 D36 C37 F38 Y39 V64 T65 Y68 R71 K77 D126 K214	L11 D12 C13 F14 Y15 V40 T41 Y44 R47 K53 D102 K190

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:2fll, PDBe:2fll, PDBj:2fll
• PDBsum: 2fll
• PubMed: 16615915
• UniProt: Q9UNA4|POLI_HUMAN DNA polymerase iota (Gene Name=POLI)