Structure of PDB 2flh Chain A

Receptor sequence
>2flhA (length=144) Species: 157791 (Vigna radiata) [Search protein sequence]
MVKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGV
GTILIFNFLPEVSPSYQREEITEFDESSHEIGLQVIEGGYLSQGLSYYKT
TFKLSEIEEDKTLVNVKISYDHVTPTKTSQSTLMYLRRLERYLS
3D structure
PDB2flh Crystal Structure of Vigna radiata Cytokinin-Specific Binding Protein in Complex with Zeatin.
ChainA
Resolution1.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZEA A L22 F26 E69 T139 Y142 L22 F26 E69 T132 Y135 MOAD: Kd=106uM
PDBbind-CN: -logKd/Ki=3.97,Kd=106uM
BS02 ZEA A L34 F58 V62 Q67 G89 Y90 Q93 L34 F58 V62 Q67 G89 Y90 Q93 MOAD: Kd=106uM
PDBbind-CN: -logKd/Ki=3.97,Kd=106uM
BS03 ZEA A K24 I27 L43 D47 G48 K24 I27 L43 D47 G48 MOAD: Kd=106uM
PDBbind-CN: -logKd/Ki=3.97,Kd=106uM
Gene Ontology
Molecular Function
GO:0004864 protein phosphatase inhibitor activity
GO:0010331 gibberellin binding
GO:0010427 abscisic acid binding
GO:0038023 signaling receptor activity
GO:0044373 cytokinin binding
Biological Process
GO:0006952 defense response
GO:0009738 abscisic acid-activated signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2flh, PDBe:2flh, PDBj:2flh
PDBsum2flh
PubMed16998071
UniProtA0A1S3THR8|PHBP_VIGRR Phytohormone-binding protein CSBP (Gene Name=CSBP)

[Back to BioLiP]