Structure of PDB 2fle Chain A |
>2fleA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGI GGFIKVRQYDQILIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF |
|
PDB | 2fle Design, synthesis, evaluation, and crystallographic-based structural studies of HIV-1 protease inhibitors with reduced response to the V82A mutation. |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
? |
|
|
|
|