Structure of PDB 2fk4 Chain A |
>2fk4A (length=67) Species: 333760 (Human papillomavirus 16) [Search protein sequence] |
AMSYSLYGTTLEQQYNKPLSDLLIRCINCQKPLSPEEKQRHLDKKQRFHN IRGRWTGRCMSCSRSSR |
|
PDB | 2fk4 Structural and functional analysis of E6 oncoprotein: insights in the molecular pathways of human papillomavirus-mediated pathogenesis |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C26 C29 C59 C62 |
C26 C29 C59 C62 |
|
|
|