Structure of PDB 2fj9 Chain A

Receptor sequence
>2fj9A (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]
SQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFT
GKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
3D structure
PDB2fj9 High resolution crystal structures of unliganded and liganded human liver ACBP reveal a new mode of binding for the acyl-CoA ligand.
ChainA
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A E11 H15 E10 H14
Gene Ontology
Molecular Function
GO:0000062 fatty-acyl-CoA binding
GO:0008289 lipid binding
GO:0030156 benzodiazepine receptor binding
GO:0036042 long-chain fatty acyl-CoA binding
GO:0042802 identical protein binding
Biological Process
GO:0006631 fatty acid metabolic process
GO:0036151 phosphatidylcholine acyl-chain remodeling
GO:1903060 negative regulation of protein lipidation
GO:1905920 positive regulation of CoA-transferase activity
GO:2001140 positive regulation of phospholipid transport
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005788 endoplasmic reticulum lumen
GO:0005794 Golgi apparatus
GO:0032994 protein-lipid complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2fj9, PDBe:2fj9, PDBj:2fj9
PDBsum2fj9
PubMed17044054
UniProtP07108|ACBP_HUMAN Acyl-CoA-binding protein (Gene Name=DBI)

[Back to BioLiP]