Structure of PDB 2fj7 Chain A

Receptor sequence
>2fj7A (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB2fj7 Nucleosome Core Particles Containing a Poly(dA.dT) Sequence Element Exhibit a Locally Distorted DNA Structure.
ChainA
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A P38 H39 R40 Y41 P43 G44 R49 R63 K64 P66 R83 P1 H2 R3 Y4 P6 G7 R12 R26 K27 P29 R46
BS02 dna A H39 R42 R63 R72 R83 S86 R116 V117 M120 H2 R5 R26 R35 R46 S49 R79 V80 M83
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2fj7, PDBe:2fj7, PDBj:2fj7
PDBsum2fj7
PubMed16860337
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]