Structure of PDB 2fgo Chain A

Receptor sequence
>2fgoA (length=81) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]
SLKITDDCINCDVCEPECPNGAISQGEEIYVIDPNLCTECVGHYDEPQCQ
QVCPVDCIPLDDANVESKDQLMEKYRKITGK
3D structure
PDB2fgo The structure of the 2[4Fe-4S] ferredoxin from Pseudomonas aeruginosa at 1.32-A resolution: comparison with other high-resolution structures of ferredoxins and contributing structural features to reduction potential values.
ChainA
Resolution1.32 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 A I4 C8 I9 N10 C11 D12 C14 Y30 C53 P54 C57 I58 I4 C8 I9 N10 C11 D12 C14 Y30 C53 P54 C57 I58
BS02 SF4 A L2 C18 I23 I32 C37 T38 E39 C40 C49 L2 C18 I23 I32 C37 T38 E39 C40 C49
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2fgo, PDBe:2fgo, PDBj:2fgo
PDBsum2fgo
PubMed16596388
UniProtQ9I6D2

[Back to BioLiP]