Structure of PDB 2fe3 Chain A

Receptor sequence
>2fe3A (length=141) Species: 1423 (Bacillus subtilis) [Search protein sequence]
HELKEALETLKETGVRITPQRHAILEYLVNSMAHPTADDIYKALEGKFPN
MSVATVYNNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIV
DFHYPGLDEVEQLAAHVTGFKVSHHRLEIYGVCQECSKKEN
3D structure
PDB2fe3 Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
ChainA
Resolution1.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C96 C99 C136 C139 C93 C96 C133 C136
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:1900376 regulation of secondary metabolite biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2fe3, PDBe:2fe3, PDBj:2fe3
PDBsum2fe3
PubMed16925555
UniProtP71086|PERR_BACSU Peroxide operon regulator (Gene Name=perR)

[Back to BioLiP]