Structure of PDB 2fac Chain A |
>2facA (length=77) Species: 562 (Escherichia coli) [Search protein sequence] |
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEF DTEIPDEEAEKITTVQAAIDYINGHQA |
|
PDB | 2fac Structural Studies of Fatty Acyl-(Acyl Carrier Protein) Thioesters Reveal a Hydrophobic Binding Cavity that Can Expand to Fit Longer Substrates. |
Chain | A |
Resolution | 1.76 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D35 |
Catalytic site (residue number reindexed from 1) |
D35 |
Enzyme Commision number |
? |
|
|
|
|