Structure of PDB 2fa9 Chain A

Receptor sequence

>2fa9A (length=169) Species: 10029 (Cricetulus griseus) [Search protein sequence]

SSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKPTSEELTIAGMTFTTF
DLGRRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPI
LILGNKIDRPEAISEERLREMFGLYGQTTGKGSVSLKELNARPLEVFMCS
VLKRQGYGEGFRWMAQYID

3D structure

PDB

2fa9 Crystal Structure of Sar1[H79G]-GDP Which Provides Insight into the Coat-controlled GTP Hydrolysis in the Disassembly of COP II

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	A	D34 N35 G37 K38 T39 T40 N134 K135 D137 S179 V180 L181	D22 N23 G25 K26 T27 T28 N105 K106 D108 S150 V151 L152

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0046872	metal ion binding
GO:0140785	amino acid sensor activity

	Biological Process
GO:0003400	regulation of COPII vesicle coating
GO:0006886	intracellular protein transport
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0015031	protein transport
GO:0016050	vesicle organization
GO:0016192	vesicle-mediated transport
GO:0032368	regulation of lipid transport
GO:0042953	lipoprotein transport
GO:0048208	COPII vesicle coating
GO:0055088	lipid homeostasis
GO:0061024	membrane organization
GO:0070863	positive regulation of protein exit from endoplasmic reticulum
GO:0090110	COPII-coated vesicle cargo loading
GO:0140353	lipid export from cell
GO:1903432	regulation of TORC1 signaling
GO:1904262	negative regulation of TORC1 signaling
GO:1990253	cellular response to leucine starvation

	Cellular Component
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005765	lysosomal membrane
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0016020	membrane
GO:0030127	COPII vesicle coat
GO:0032580	Golgi cisterna membrane
GO:0070971	endoplasmic reticulum exit site

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2fa9, PDBe:2fa9, PDBj:2fa9
PDBsum	2fa9
PubMed
UniProt	Q9QVY3\|SAR1B_CRIGR Small COPII coat GTPase SAR1B (Gene Name=SAR1B)

[Back to BioLiP]