Structure of PDB 2f9v Chain A

Receptor sequence

>2f9vA (length=183) [Search protein sequence]

MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCI
NGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCT
CGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAG
HAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS

3D structure

PDB

2f9v Depeptidization efforts on P3-P2 a-ketoamide inhibitors of HCV NS3-4A serine protease: Effect on HCV replicon activity.

Chain

Resolution

2.6 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H57 D81 G137 S139
Catalytic site (residue number reindexed from 1)	H59 D83 G139 S141
Enzyme Commision number	2.7.7.48: RNA-directed RNA polymerase. 3.4.21.98: hepacivirin. 3.4.22.- 3.6.1.15: nucleoside-triphosphate phosphatase. 3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	A5 Y6 A7 Q8 T10 R11 C16 T19 S20 E30 E32 V33 I35 V36 S37 R62 T63 I64 A65 R92 R109	A7 Y8 A9 Q10 T12 R13 C18 T21 S22 E32 E34 V35 I37 V38 S39 R64 T65 I66 A67 R94 R111
BS02	peptide	A	T4 A5 Y6 A7	T6 A7 Y8 A9
BS03	ZN	A	C97 C99 C145	C99 C101 C147
BS04	BN6	A	Q41 T42 H57 I132 L135 K136 G137 S139 R155 A156 A157 C159	Q43 T44 H59 I134 L137 K138 G139 S141 R157 A158 A159 C161	PDBbind-CN: -logKd/Ki=7.82,Ki=15nM

Gene Ontology

	Molecular Function
GO:0008236	serine-type peptidase activity

	Biological Process
GO:0006508	proteolysis
GO:0019087	transformation of host cell by virus

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2f9v, PDBe:2f9v, PDBj:2f9v
PDBsum	2f9v
PubMed	16387495
UniProt	P27958\|POLG_HCV77 Genome polyprotein

[Back to BioLiP]