Structure of PDB 2f9m Chain A

Receptor sequence

>2f9mA (length=182) Species: 9606 (Homo sapiens) [Search protein sequence]

MYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVD
GKTIKAQIWDTAGQERYRRITSAYYRGAVGALLVYDIAKHLTYENVERWL
KELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSAL
DSTNVEEAFKNILTEIYRIVSQKQIADRAAHD

3D structure

PDB

2f9m The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.

Chain

Resolution

1.95 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	S25 T43	S19 T37
BS02	GNP	A	S20 G21 G23 K24 S25 N26 F36 N37 L38 S40 S42 T43 A68 G69 N124 K125 D127 L128 S154 A155 L156	S14 G15 G17 K18 S19 N20 F30 N31 L32 S34 S36 T37 A62 G63 N118 K119 D121 L122 S148 A149 L150

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019003	GDP binding
GO:0031489	myosin V binding
GO:0045296	cadherin binding

	Biological Process
GO:0001881	receptor recycling
GO:0015031	protein transport
GO:0032402	melanosome transport
GO:0032456	endocytic recycling
GO:0033572	transferrin transport
GO:0035773	insulin secretion involved in cellular response to glucose stimulus
GO:0044070	regulation of monoatomic anion transport
GO:0045054	constitutive secretory pathway
GO:0045055	regulated exocytosis
GO:0071468	cellular response to acidic pH
GO:0090150	establishment of protein localization to membrane
GO:0150093	amyloid-beta clearance by transcytosis
GO:2000008	regulation of protein localization to cell surface
GO:2001135	regulation of endocytic recycling

	Cellular Component
GO:0005737	cytoplasm
GO:0005768	endosome
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0008021	synaptic vesicle
GO:0016020	membrane
GO:0030670	phagocytic vesicle membrane
GO:0030672	synaptic vesicle membrane
GO:0045202	synapse
GO:0045335	phagocytic vesicle
GO:0055037	recycling endosome
GO:0055038	recycling endosome membrane
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2f9m, PDBe:2f9m, PDBj:2f9m
PDBsum	2f9m
PubMed	16545962
UniProt	Q15907\|RB11B_HUMAN Ras-related protein Rab-11B (Gene Name=RAB11B)

[Back to BioLiP]