Structure of PDB 2f9g Chain A

Receptor sequence
>2f9gA (length=332) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MPKRIVYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKP
LFALRTLREIKILKHFKHENIITIFNIQRPDSFENFNEVYIIQELMQTDL
HRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCD
LKVCDFGLARIIDTRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRP
IFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPAAPL
EKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDEPEG
EPIPPSFFEFDHYKEALTTKDLKKLIWNEIFS
3D structure
PDB2f9g The Ste5 scaffold allosterically modulates signaling output of the yeast mating pathway.
ChainA
Resolution2.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D137 K139 N142 D155 T185
Catalytic site (residue number reindexed from 1) D137 K139 N142 D155 T164
Enzyme Commision number 2.7.11.24: mitogen-activated protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A N142 D155 N142 D155
BS02 ADP A L19 V27 A40 K42 Q93 M96 D99 S141 L144 D155 L19 V27 A40 K42 Q93 M96 D99 S141 L144 D155
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004707 MAP kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0042802 identical protein binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000749 response to pheromone triggering conjugation with cellular fusion
GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
GO:0001403 invasive growth in response to glucose limitation
GO:0006468 protein phosphorylation
GO:0010526 retrotransposon silencing
GO:0016310 phosphorylation
GO:0035556 intracellular signal transduction
GO:0043409 negative regulation of MAPK cascade
GO:0046827 positive regulation of protein export from nucleus
GO:0051301 cell division
GO:0071507 pheromone response MAPK cascade
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0010494 cytoplasmic stress granule
GO:0042597 periplasmic space
GO:0043332 mating projection tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2f9g, PDBe:2f9g, PDBj:2f9g
PDBsum2f9g
PubMed16424299
UniProtP16892|FUS3_YEAST Mitogen-activated protein kinase FUS3 (Gene Name=FUS3)

[Back to BioLiP]