Structure of PDB 2f8p Chain A

Receptor sequence

>2f8pA (length=190) Species: 32570 (Obelia longissima)

ASKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDIC
AKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELK
KWARNEPTLIREWGDAVFDIFDKDGSGTITLDEWKAYGKISGISPSQEDC
EATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYG

3D structure

• PDB: 2f8p Crystal structure of obelin after Ca2+-triggered bioluminescence suggests neutral coelenteramide as the primary excited state.
• Chain: A
• Resolution: 1.93 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H22 W92 Y138 H175 Y190
• Catalytic site (residue number reindexed from 1): H21 W91 Y137 H174 Y189

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D30 N32 N34 K36 E41	D29 N31 N33 K35 E40
BS02	CA	A	D123 D125 S127 T129 E134	D122 D124 S126 T128 E133
BS03	CA	A	D159 D161 S163 D165 E170	D158 D160 S162 D164 E169
BS04	CEI	A	H22 M25 L29 A46 I50 F72 F88 W92 W114 G115 V118 M171 H175 W179 Y190	H21 M24 L28 A45 I49 F71 F87 W91 W113 G114 V117 M170 H174 W178 Y189

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0008218 bioluminescence

External links

• PDB: RCSB:2f8p, PDBe:2f8p, PDBj:2f8p
• PDBsum: 2f8p
• PubMed: 16467137
• UniProt: Q27709|OBL_OBELO Obelin