Structure of PDB 2f8n Chain A

Receptor sequence
>2f8nA (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB2f8n Nucleosomes containing the histone domain of macroH2A: In vitro possibilities.
ChainA
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R442 P443 T445 R463 R472 R483 F484 Q485 R516 V517 T518 R5 P6 T8 R26 R35 R46 F47 Q48 R79 V80 T81
BS02 dna A H439 R440 Y441 R442 G444 T445 V446 A447 R449 R463 K464 L465 R469 R483 H2 R3 Y4 R5 G7 T8 V9 A10 R12 R26 K27 L28 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2f8n, PDBe:2f8n, PDBj:2f8n
PDBsum2f8n
PubMed
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]