Structure of PDB 2f5f Chain A

Receptor sequence
>2f5fA (length=133) Species: 1423 (Bacillus subtilis) [Search protein sequence]
PSMEDYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLI
YEKYRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVEGIEH
HLSWNSIDRIGDLVQYFEEDDARKKDLKSIQKK
3D structure
PDB2f5f Structural Basis for the Metal-Selective Activation of the Manganese Transport Regulator of Bacillus subtilis.
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN A E11 H77 E99 E102 E8 H74 E96 E99
BS02 MN A D8 E99 E102 H103 D5 E96 E99 H100
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0030145 manganese ion binding
GO:0046872 metal ion binding
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0030026 intracellular manganese ion homeostasis
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2f5f, PDBe:2f5f, PDBj:2f5f
PDBsum2f5f
PubMed16533030
UniProtP54512|MNTR_BACSU HTH-type transcriptional regulator MntR (Gene Name=mntR)

[Back to BioLiP]