Structure of PDB 2f4f Chain A |
>2f4fA (length=130) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] |
ELKSTRHTKYLCNYHFVWIPKHRRNTLVNEIAEYTKEVLKSIAEELGCEI IALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFPQLNKGKLW TRSYFVATAGNVSSEVIKKYIEEQWRKEGE |
|
PDB | 2f4f Crystal Structure of a Metal Ion-bound IS200 Transposase |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
E55 H62 |
E54 H61 |
|
|
|
|