Structure of PDB 2f49 Chain A

Receptor sequence
>2f49A (length=335) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KRIVYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLF
ALRTLREIKILKHFKHENIITIFNIQRPDSFENFNEVYIIQELMQTDLHR
VISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLK
VCDFGLARIIDVEFVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFL
RRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPA
APLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDE
PEGEPIPPSFFEFDHYKEALTTKDLKKLIWNEIFS
3D structure
PDB2f49 The Ste5 scaffold allosterically modulates signaling output of the yeast mating pathway
ChainA
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D137 K139 N142 D155 T185
Catalytic site (residue number reindexed from 1) D135 K137 N140 D153 T167
Enzyme Commision number 2.7.11.24: mitogen-activated protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A K3 R4 I5 V6 Y7 N8 I9 S10 S11 F13 L15 D112 H113 Y116 Y119 S147 Y312 D314 D317 K1 R2 I3 V4 Y5 N6 I7 S8 S9 F11 L13 D110 H111 Y114 Y117 S145 Y294 D296 D299
BS02 MG A Y24 G25 I44 E45 K49 Y22 G23 I42 E43 K47
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004707 MAP kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0042802 identical protein binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000749 response to pheromone triggering conjugation with cellular fusion
GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
GO:0001403 invasive growth in response to glucose limitation
GO:0006468 protein phosphorylation
GO:0010526 retrotransposon silencing
GO:0016310 phosphorylation
GO:0035556 intracellular signal transduction
GO:0043409 negative regulation of MAPK cascade
GO:0046827 positive regulation of protein export from nucleus
GO:0051301 cell division
GO:0071507 pheromone response MAPK cascade
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0010494 cytoplasmic stress granule
GO:0042597 periplasmic space
GO:0043332 mating projection tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2f49, PDBe:2f49, PDBj:2f49
PDBsum2f49
PubMed16424299
UniProtP16892|FUS3_YEAST Mitogen-activated protein kinase FUS3 (Gene Name=FUS3)

[Back to BioLiP]