Structure of PDB 2f3k Chain A |
>2f3kA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGI GGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 2f3k Substrate envelope and drug resistance: crystal structure of RO1 in complex with wild-type human immunodeficiency virus type 1 protease. |
Chain | A |
Resolution | 1.599 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
3.4.23.16: HIV-1 retropepsin. |
|
|
|
|