Structure of PDB 2f2o Chain A

Receptor sequence
>2f2oA (length=156) Species: 9913 (Bos taurus) [Search protein sequence]
TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE
VDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAE
LRHVMTNLKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAIRNKIRAIG
KMARVF
3D structure
PDB2f2o Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
ChainA
Resolution2.17 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V31
Enzyme Commision number ?
3.1.3.16: protein-serine/threonine phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D20 D22 D24 T26 E31 D16 D18 D20 T22 E27
BS02 CA A D56 D58 N60 T62 E67 D52 D54 N56 T58 E63
BS03 CA A D93 D95 N97 Y99 E104 D89 D91 N93 Y95 E100
BS04 CA A D129 D131 D133 Q135 E140 D123 D125 D127 Q129 E134
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0019904 protein domain specific binding
GO:0046872 metal ion binding
Biological Process
GO:0010880 regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0060315 negative regulation of ryanodine-sensitive calcium-release channel activity
GO:0060316 positive regulation of ryanodine-sensitive calcium-release channel activity
Cellular Component
GO:0000922 spindle pole
GO:0005737 cytoplasm
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2f2o, PDBe:2f2o, PDBj:2f2o
PDBsum2f2o
PubMed16411749
UniProtP48452|PP2BA_BOVIN Protein phosphatase 3 catalytic subunit alpha (Gene Name=PPP3CA);
P62157|CALM_BOVIN Calmodulin (Gene Name=CALM)

[Back to BioLiP]