Structure of PDB 2f17 Chain A

Receptor sequence

>2f17A (length=255) Species: 10090 (Mus musculus)

HHSSGLVPRGSHMEHAFTPLEPLLPTGNLKYCLVVLNQPLDARFRHLWKK
ALLRACADGGANHLYDLTEGERESFLPEFVSGDFDSIRPEVKEYYTKKGC
DLISTPDQDHTDFTKCLQVLQRKIEEKELQVDVIVTLGGLGGRFDQIMAS
VNTLFQATHITPVPIIIIQKDSLIYLLQPGKHRLHVDTGMEGSWCGLIPV
GQPCNQVTTTGLKWNLTNDVLGFGTLVSTSNTYDGSGLVTVETDHPLLWT
MAIKS

3D structure

• PDB: 2f17 Pyrithiamine as a substrate for thiamine pyrophosphokinase
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 2.7.6.2: thiamine diphosphokinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	D46 D71 D73 D100	D58 D83 D85 D112
BS02	PYI	A	Q96 D97 H98 T99 D100 R131 Q134	Q108 D109 H110 T111 D112 R143 Q146
BS03	AMP	A	N25 Q26 A45 D46 S74 D100 F101 G127 G129 G130 R131 Q134	N37 Q38 A57 D58 S86 D112 F113 G139 G141 G142 R143 Q146
BS04	PYI	A	W202 S216 T217 S218 N219	W214 S228 T229 S230 N231

Gene Ontology

Molecular Function

• GO:0004788 thiamine diphosphokinase activity
• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0030975 thiamine binding
• GO:0042802 identical protein binding
• GO:0141200 UTP thiamine diphosphokinase activity

Biological Process

• GO:0006772 thiamine metabolic process
• GO:0009229 thiamine diphosphate biosynthetic process
• GO:0010510 regulation of acetyl-CoA biosynthetic process from pyruvate
• GO:0016310 phosphorylation
• GO:0042723 thiamine-containing compound metabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2f17, PDBe:2f17, PDBj:2f17
• PDBsum: 2f17
• PubMed: 16365036
• UniProt: Q9R0M5|TPK1_MOUSE Thiamine pyrophosphokinase 1 (Gene Name=Tpk1)