Structure of PDB 2f02 Chain A

Receptor sequence

>2f02A (length=319) Species: 226185 (Enterococcus faecalis V583)

SLIVTVTMNPSIDISYLLDHLKLDTVNRTSQVTKTPGGKGLNVTRVIHDL
GGDVIATGVLGGFHGAFIANELKKANIPQAFTSIKEETRDSIAILHEGNQ
TEILEAGPTVSPEEISNFLENFDQLIKQAEIVTISGSLAKGLPSDFYQEL
VQKAHAQEVKVLLDTSGDSLRQVLQGPWKPYLIKPNLEELEGLLGQDFSE
NPLAAVQTALTKPMFAGIEWIVISLGKDGAIAKHHDQFYRVKIPTIQAKN
PVGSGDATIAGLAYGLAKDAPAAELLKWGMAAGMANAQERMTGHVDVENV
KKHLMNIQVVEIAKEGHHH

3D structure

• PDB: 2f02 Crystal Structure of LacC from Enterococcus Faecalis in complex with ATP
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.144: tagatose-6-phosphate kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	N185 S223 G225 I242 I245 G252 S253 G254 T257 M279 G282 M283	N186 S224 G226 I243 I246 G253 S254 G255 T258 M280 G283 M284

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0008443 phosphofructokinase activity
• GO:0009024 tagatose-6-phosphate kinase activity
• GO:0016301 kinase activity
• GO:0016772 transferase activity, transferring phosphorus-containing groups
• GO:0016773 phosphotransferase activity, alcohol group as acceptor

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0005988 lactose metabolic process
• GO:0016310 phosphorylation
• GO:0019512 lactose catabolic process via tagatose-6-phosphate
• GO:0046835 carbohydrate phosphorylation
• GO:2001059 D-tagatose 6-phosphate catabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:2f02, PDBe:2f02, PDBj:2f02
• PDBsum: 2f02
• UniProt: Q833W9|LACC_ENTFA Tagatose-6-phosphate kinase (Gene Name=lacC)