Structure of PDB 2f01 Chain A

Receptor sequence

>2f01A (length=121) Species: 1895 (Streptomyces avidinii)

EAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSA
PATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSG
TTEANAWKSTLVGHDTFTKVK

3D structure

• PDB: 2f01 The high-resolution structure of (+)-epi-biotin bound to streptavidin.
• Chain: A
• Resolution: 0.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BTN	A	L25 S27 Y43 S45 V47 N49 W79 S88 T90 W108 D128	L12 S14 Y30 S32 V34 N36 W66 S75 T77 W95 D115	MOAD: Kd~0.1pM PDBbind-CN: -logKd/Ki=13.00,Kd=0.1pM BindingDB: Kd=1.000000nM
BS02	BTQ	A	L25 S27 Y43 S45 V47 N49 W79 S88 W108 D128	L12 S14 Y30 S32 V34 N36 W66 S75 W95 D115	MOAD: Kd~0.1pM

Gene Ontology

Molecular Function

• GO:0009374 biotin binding

External links

• PDB: RCSB:2f01, PDBe:2f01, PDBj:2f01
• PDBsum: 2f01
• PubMed: 16699183
• UniProt: P22629|SAV_STRAV Streptavidin