Structure of PDB 2exf Chain A

Receptor sequence

>2exfA (length=44) Species: 11678 (Human immunodeficiency virus type 1 BH10)

NVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN

3D structure

• PDB: 2exf How the HIV-1 nucleocapsid protein binds and destabilises the (-)primer binding site during reverse transcription.
• Chain: A
• Resolution: N/A

Enzymatic activity

• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.
  3.4.23.16: HIV-1 retropepsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	N12 V13 K14 F16 G22 T24 R26 N27 R32 K34 G35 C36 W37 Q45 M46 K47	N1 V2 K3 F5 G11 T13 R15 N16 R21 K23 G24 C25 W26 Q34 M35 K36
BS02	ZN	A	C15 C18 H23 C28	C4 C7 H12 C17
BS03	ZN	A	C36 C39 H44 C49	C25 C28 H33 C38

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008270 zinc ion binding

External links

• PDB: RCSB:2exf, PDBe:2exf, PDBj:2exf
• PDBsum: 2exf
• PubMed: 18773912
• UniProt: P03366|POL_HV1B1 Gag-Pol polyprotein (Gene Name=gag-pol)